PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo17G0004400
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family MYB
Protein Properties Length: 281aa    MW: 32172.4 Da    PI: 7.1054
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo17G0004400genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.26.6e-171057148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT eEd ll ++v q+G g+W++I+++ g++R++k+c++rw++yl
  Spipo17G0004400 10 KGAWTLEEDALLQRCVLQYGEGQWHLIPERAGLRRCRKSCRLRWLNYL 57
                     79********************************************97 PP

2Myb_DNA-binding45.32e-1463107147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++ ++E +l+++++++lG++ W++Ia +++ gRt++++k++w++ 
  Spipo17G0004400  63 RGAFQEDEVDLIIRLHRLLGNR-WSLIAGRIP-GRTANDIKNYWNSC 107
                      899*******************.*********.***********975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129423.222161IPR017930Myb domain
SuperFamilySSF466897.26E-278104IPR009057Homeodomain-like
SMARTSM007175.7E-14959IPR001005SANT/Myb domain
PfamPF002491.8E-151057IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.0E-211164IPR009057Homeodomain-like
CDDcd001671.19E-91257No hitNo description
PROSITE profilePS5129418.33862112IPR017930Myb domain
SMARTSM007179.6E-1162110IPR001005SANT/Myb domain
PfamPF002491.8E-1363107IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-2265111IPR009057Homeodomain-like
CDDcd001671.86E-868105No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009753Biological Processresponse to jasmonic acid
GO:0031540Biological Processregulation of anthocyanin biosynthetic process
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 281 aa     Download sequence    Send to blast
MENQVAKIRK GAWTLEEDAL LQRCVLQYGE GQWHLIPERA GLRRCRKSCR LRWLNYLKPS  60
IKRGAFQEDE VDLIIRLHRL LGNRWSLIAG RIPGRTANDI KNYWNSCLCK KVGAQGKVAR  120
NINKRSTIGL AAETYNSCIW GRATLSPRIA HPPEAILGCR HEIFRPRPRT MSDGPICLPD  180
IITYREPFPG GHCCSSTNER PDNEQELVAW TRLLLEDDGK DQGHRQQEER EDKDAISFPV  240
EEELRHWPPQ TDDEVEGDWW PLGWEDILLD ANPTSGTFSG *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-23101127108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00213DAPTransfer from AT1G66370Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010064838.13e-56PREDICTED: transcription factor MYB114-like
TrEMBLB9T6Z25e-56B9T6Z2_RICCO; R2r3-myb transcription factor, putative (Fragment)
TrEMBLW8EB735e-56W8EB73_ERYLE; Anthocyanin-activating R2R3 MYB transcription factor
STRINGSolyc10g086250.1.18e-54(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66370.13e-57myb domain protein 113